PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010916375.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 313aa    MW: 35458.2 Da    PI: 8.278
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010916375.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.3e-5651301128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv++  + + ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_010916375.1   5 LPPGFRFHPTDEELITYYLTRKVSDFGFAA-KAIADVDLNKCEPWDLPGKASMGEKEWYFFSLRDRKYPTGMRTNRATDAGYWKTTGKDKEIFH- 97 
                     79*************************999.88***************988999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      g lvg+kktLvfykgrapkgekt+Wvmheyrl
  XP_010916375.1  98 CGVLVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 130
                     9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-653151IPR003441NAC domain
PROSITE profilePS5100560.2875151IPR003441NAC domain
PfamPF023656.1E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT YYLTRKVSDF GFAAKAIADV DLNKCEPWDL PGKASMGEKE  60
WYFFSLRDRK YPTGMRTNRA TDAGYWKTTG KDKEIFHCGV LVGMKKTLVF YKGRAPKGEK  120
TNWVMHEYRL QTKFPYRSTK EEWVVCRVFK KSSNGKKTQP NTPPLPPLLE SPCNTTSLSE  180
LGELDVSILN NLVNTSNGPD GMQINDNINN RVDMNMYMNW ILAREATSQP SLPWPSSLLG  240
MSYLPSPAIL KALPFNGYQP QEDANLTSLS SFAAQGNPML GESRSSFPSS STKGTEVPQQ  300
QHPFDQEPIW RGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-59415716171NO APICAL MERISTEM PROTEIN
1ut4_B7e-59415716171NO APICAL MERISTEM PROTEIN
1ut7_A7e-59415716171NO APICAL MERISTEM PROTEIN
1ut7_B7e-59415716171NO APICAL MERISTEM PROTEIN
3swm_A6e-59415719174NAC domain-containing protein 19
3swm_B6e-59415719174NAC domain-containing protein 19
3swm_C6e-59415719174NAC domain-containing protein 19
3swm_D6e-59415719174NAC domain-containing protein 19
3swp_A6e-59415719174NAC domain-containing protein 19
3swp_B6e-59415719174NAC domain-containing protein 19
3swp_C6e-59415719174NAC domain-containing protein 19
3swp_D6e-59415719174NAC domain-containing protein 19
4dul_A7e-59415716171NAC domain-containing protein 19
4dul_B7e-59415716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916375.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLR34e-83NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM0TRJ51e-133M0TRJ5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P18420_0011e-133(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-99NAC domain containing protein 58